Last reviewed · How we verify
NCT04051307
Dual Vaccine Trial in Myeloproliferative Neoplasms
Phase 1, PHASE2 trial testing PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL in Polycythemia Vera in 9 participants. Completed in 10 July 2022.
10 July 2022
Quick facts
| Lead sponsor | Inge Marie Svane |
|---|---|
| Phase | Phase 1, PHASE2 |
| Status | Completed |
| Study type | INTERVENTIONAL |
| Allocation | na |
| Design | single group |
| Masking | none |
| Primary purpose | treatment |
| Enrollment | 9 |
| Start date | 10 July 2019 |
| Primary completion | 10 July 2022 |
| Estimated completion | 10 July 2022 |
| Sites | 2 locations across Denmark |
Drugs / interventions tested
- PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL — full drug profile →
- Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL — full drug profile →
Conditions studied
- Polycythemia Vera — all drugs for Polycythemia Vera →
- Essential Thrombocythemia — all drugs for Essential Thrombocythemia →
Sponsor
Inge Marie Svane — full company profile →
Who can join
18 and older, any sex, with Polycythemia Vera or Essential Thrombocythemia. Patients with the condition only — healthy volunteers not accepted.
Sponsor's own description
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and clinical effect.
Publications & conference data
8 peer-reviewed publications reference this trial (live from Europe PMC):
-
Cancer vaccines as promising immuno-therapeutics: platforms and current progress.
Liu J, Fu M, Wang M, Wan D, et al · · 2022 · cited 497× · PMID 35303904 · DOI 10.1186/s13045-022-01247-x -
Beyond Just Peptide Antigens: The Complex World of Peptide-Based Cancer Vaccines.
Stephens AJ, Burgess-Brown NA, Jiang S. · · 2021 · cited 112× · PMID 34276688 · DOI 10.3389/fimmu.2021.696791 -
Therapeutic cancer vaccines: From biological mechanisms and engineering to ongoing clinical trials.
Sobhani N, Scaggiante B, Morris R, Chai D, et al · · 2022 · cited 57× · PMID 35759856 · DOI 10.1016/j.ctrv.2022.102429 -
Mechanisms of immune modulation in the tumor microenvironment and implications for targeted therapy.
Czajka-Francuz P, Prendes MJ, Mankan A, Quintana Á, et al · · 2023 · cited 46× · PMID 37427115 · DOI 10.3389/fonc.2023.1200646 -
Current Methods of Post-Translational Modification Analysis and Their Applications in Blood Cancers.
Dunphy K, Dowling P, Bazou D, O'Gorman P. · · 2021 · cited 46× · PMID 33923680 · DOI 10.3390/cancers13081930 -
Targeting Myeloid-Derived Suppressor Cells in Cancer Immunotherapy.
Wang Y, Jia A, Bi Y, Wang Y, et al · · 2020 · cited 45× · PMID 32942545 · DOI 10.3390/cancers12092626 -
Therapeutic Cancer Vaccination With a Peptide Derived From the Calreticulin Exon 9 Mutations Induces Strong Cellular Immune Responses in Patients With <i>CALR</i>-Mutant Chronic Myeloproliferative Neoplasms.
Handlos Grauslund J, Holmström MO, Jørgensen NG, Klausen U, et al · · 2021 · cited 38× · PMID 33718228 · DOI 10.3389/fonc.2021.637420 -
Arginase-1 targeting peptide vaccine in patients with metastatic solid tumors - A phase I trial.
Lorentzen CL, Martinenaite E, Kjeldsen JW, Holmstroem RB, et al · · 2022 · cited 36× · PMID 36330525 · DOI 10.3389/fimmu.2022.1023023
Verify or expand the search:
- PubMed search for NCT04051307
- Europe PMC full search
- ASCO Meeting Library
- ESMO Meeting Library
- bioRxiv preprints
- medRxiv preprints
- Google Scholar
Related trials
Other recruiting trials for Polycythemia Vera
Currently open trials in the same condition.
- NCT07203768 — A ELN-Multicenter Study on Phenotypic Evolution and Clinical Outcomes · recruiting
- NCT07362225 — MPN PROGRESSion Registry: Observational Study Tracking Symptoms, Treatments, and Disease Progression in People With Myel · recruiting
- NCT06661915 — A Randomized Study of ASTX727 With or Without Iadademstat in Advanced Myeloproliferative Neoplasms (MPNs) · Phase 2 · recruiting
- NCT06752941 — LOW-PV Continuation · recruiting
- NCT06734637 — Efficacy and Safety of Peginterferon in ET and PV. · NA · recruiting
Other Inge Marie Svane trials
Trials by the same sponsor.
- NCT07501117 — Neoadjuvant Immunotherapy for Patients With High-risk Eye Melanoma · Phase 1 · not yet recruiting
- NCT06204991 — To Evaluate the Safety and Efficacy of ADP-TILIL7 in Patients With Locally Advanced or Metastatic Melanoma · Phase 1 · recruiting
- NCT06783270 — T-cell Therapy with CRISPR PD1-edited Tumor Infiltrating Lymphocytes for Patients with Metastatic Melanoma · Phase 1 · recruiting
- NCT04904185 — ImmPACT Expanded Multiple Antigen Specific Endogenously Derived T Cells (MASE-T) to Patients With Metastatic Melanoma · Phase 1 · terminated
- NCT04611126 — T-cell Therapy in Combination With Nivolumab, Relatlimab and Ipilimumab for Patients With Metastatic Ovarian Cancer · Phase 1, PHASE2 · terminated
Verify against primary sources
- ClinicalTrials.gov — authoritative US registry record
- WHO ICTRP — international registry index
- EU Clinical Trials Register
- Sponsor press releases (Google)
- Trial protocol + status: ClinicalTrials.gov NCT04051307 (US National Library of Medicine, public domain)
- Publications: Europe PMC API search by NCT ID, retrieved 10 June 2026
- Drug + disease cross-links: matched in real time against Drug Landscape's normalised drug + company + condition tables
- Sponsor: as reported to ClinicalTrials.gov by Inge Marie Svane
- Last refreshed: 13 July 2023
Drug Landscape aggregates and links these public records for informational use only. Always verify against the primary source before clinical or regulatory decisions. Canonical URL: https://druglandscape.com/trial/NCT04051307.
Primary sources · FDA · ClinicalTrials.gov · EMA · SEC EDGAR · ChEMBL · Wikidata · full sourcing