EP4591934A2 — Variants of c-type natriuretic peptide
Assigned to Biomarin Pharmaceutical Inc · Expires 2025-07-30 · 1y expired
What this patent protects
The invention provides a conjugate of a C-type natriuretic peptide (CNP) variant, wherein the amino acid sequence of the CNP variant is LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (CNP-38), and a polyethylene glycol (PEG) polymer, and its use for the treatment of disorders of bone gr…
USPTO Abstract
The invention provides a conjugate of a C-type natriuretic peptide (CNP) variant, wherein the amino acid sequence of the CNP variant is LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (CNP-38), and a polyethylene glycol (PEG) polymer, and its use for the treatment of disorders of bone growth such as skeletal dysplasia.
Drugs covered by this patent
Bibliographic data sourced from FDA Orange Book + USPTO public records. Plain-English summary generated by AI grounded in source text. Patent term extensions (PTR, SPC, pediatric) may shift the effective expiry. Not legal advice.
Track this patent
Get a daily-checked alert when vulnerability score, expiry, classification, or assignee changes. Email, Slack, or Teams delivery. Pro: 50 watches, Free: 3.