EP4523749A3 — Variants of c-type natriuretic peptide
Assigned to Biomarin Pharmaceutical Inc · Expires 2025-05-07 · 1y expired
What this patent protects
The invention provides a C-type natriuretic peptide (CNP) variant, wherein the amino acid sequence of the CNP variant is LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (CNP-38), a conjugate comprising the CNP variant and a hydrophilic polymer, and their use for the treatment of a bone-re…
USPTO Abstract
The invention provides a C-type natriuretic peptide (CNP) variant, wherein the amino acid sequence of the CNP variant is LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (CNP-38), a conjugate comprising the CNP variant and a hydrophilic polymer, and their use for the treatment of a bone-related disorder or skeletal dysplasia.
Drugs covered by this patent
Bibliographic data sourced from FDA Orange Book + USPTO public records. Plain-English summary generated by AI grounded in source text. Patent term extensions (PTR, SPC, pediatric) may shift the effective expiry. Not legal advice.
Track this patent
Get a daily-checked alert when vulnerability score, expiry, classification, or assignee changes. Email, Slack, or Teams delivery. Pro: 50 watches, Free: 3.